- Two Spotted Spider (Adult)  Don’t just kills bugs; create a bug barrier with Ortho® Home Defense® Insect Killer for Indoor & Perimeter2 with Comfort Wand®. - Lygus Bug Ortho Home Defense Insect Killer for Lawn and Landscape Concentrate treats up to 5,300 sq. How to use and dangers of Ortho Home Defense spray? We would recommend calling Scotts directly at 1-888-270-3714. Bedlam Plus Bed Bug Aerosol, 17 Fl. It is great for large areas and kills even the toughest pyrethroid resistant bed bugs. Use with confidence in bedrooms, closets and family rooms to kill bed bugs, fleas and brown dog ticks. - WolfSPITTLEBUGS is Ready-to-Use Perimeter and Indoor Insect Killer. Ortho Home Defense MAX Insect Killer Indoor & Perimeter with Comfort Wand is specially formulated to help prevent and control home invading insects for up to 12 months. Weeds. Home Ortho 4600810 Home Defense Max Insect Killer, 1 Gal. This product comes in a nonrefillable container. Use with confidence in bathroom, kitchens, family rooms, pantries, attics, garages, basements, closets, storage areas, and bedrooms. Give yourself peace of mind with Ortho Home Defense Termite and Destructive Bug Killer (Not available in MA, NY or RI). Use it as a spot treatment to kill the bed bugs … Set spray nozzle to indoor setting. - Red/Western HarvesterAPHIDS This Home Defense Insect Kills and prevents ants, cockroaches, spiders and other listed insects. Raid Ant And Roach Killer, 17.5 Fl. If Empty: Do not reuse or refill this container. Ortho. • Up to 12‐month protection (against ants, roaches and spiders indoors. It uses Bifenthrin as its active ingredient which effectively kill insect pests like ants, cockroaches, centipedes, earwigs, fleas, ticks, millipedes, silverfish, spiders, and other listed insects. Always read and follow the product label before use. - Artichoke Plume Free shipping. Effective indoor and perimeter insect control; Use the new Wand for easy perimeter application. For best results and a healthy environment, please follow instructions for appropriate usage, storage and disposal. Buy on Amazon Buy on Home … - Black Turfgrass Ataenius You may need consider between hundred or thousand products from many store. Ortho 0220810 Home Defense Insect Killer for Indoor & Perimeter2 Ready-to-Use, 1 GAL, V $7.43 $7.43 + 4 Deal Score. For 100+ listed insects, see label. The Ortho® Guarantee: If for any reason you, the consumer, are not satisfied with this product, mail us your original proof of purchase to obtain a full refund of your purchase price. Apply a 12 inch band along the exterior perimeter of your home in areas where insects are a recurring problem. - Alder - Black Widow This creates a bug killing barrier. - Saltmarsh Use with confidence in bedrooms, closets and family rooms to kill bed bugs, fleas and brown dog ticks. 4.8 /5. - Japanese (Adults) ... and then otherwise choose to seal up the other entrances into the home bugs can use. - Cherry Fruit The Best Natural Spray. - Argentine - Squash BugLEAFHOPPERSLEAFMINERS Ortho Home Defense Bed Bug Killer Offers, Deals and Coupons 2021 - Up To 30% Off Coupon Code - by Getrefe Team Ortho Home Defense Bed Bug Killer Offers, Deals and Coupons 2021 - Up To 30% Off Coupon Code. Apply a 4 inch band along the interior of your home in areas where insects are a recurring problem. If you have the occasional fly or gnat in the house, chances are you’ll also have spiders in the house. It is great for large areas and kills even the toughest pyrethroid resistant bed bugs. - Imported Cabbageworm Loopers (Alfalfa, Cabbage, Celery)  $10 for both - cash or Venmo - Foraging Fire Ants They have 4 pairs of legs and no antennae. Ortho Home Defense Insect Killer for Cracks & Crevices - Spray Foam Kills Ants, Cockroaches, Fleas, Centipedes, Crickets, Boxelder Bugs & Other Listed Common Insects, Long-Lasting, 16 oz. Apply a 4-inch barrier around baseboards, tubs, and cabinets. Do not apply to hard surfaces such as sidewalks, driveways and streets where the product is likely to wash off into sewers and waterways. Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho … Ortho Home Defense Insect Killer for Lawn & Landscape Ready-to-Spray - Treats up to 5,300 sq. A 10 lb. ft. area of lawn using a spreader designed for the application of granular materials. The Ortho Home Defense Max 1.33 Gal. - Filbertworm World rights reserved. Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho® to keep them out. is Ready-to-Use The Ortho Home Defense Max 1.33 Gal. 4.3 out of 5 … - Pecan Leaf Don’t just kill bugs, create a bug barrier with Ortho Home Defense Insect Killer Granules 3. This product features a sprayer for application of the fast-drying, non-staining formula. Ortho Home Defense Max Bed Bug, Flea and Tick Killer is the second step in a bed bug solution system. Simply apply Ortho Home Defense Insect Killer Granules 3 around the perimeter of your home foundation for up to 3 months* of control. - Spruce Apply indoor or outdoors according to label instructions. Do not apply this product, or allow it to drift, to blooming plants if bees are visiting the treatment area. 5 1. - Oblique Banded - PearSAWFLIES ft. The Ortho Home Defense Max 1.33 Gal. - Striped Cucumber Weevils (Annual Bluegrass & Black Vine) BORERS Whether you have ants, spiders, roaches or other home-invading insects, you can count on Ortho to keep them out. - Pharaoh/Sugar That's why Ortho® products are designed with care to provide effective solutions to insect problems outside your home. Use it as a spot treatment to kill the bed bugs … We apologize, butuUnfortunately, we haven’t hear of this issue with the Ortho Home Defense MAX Insect Killer Indoor & Perimeter with Comfort Wand. Answer last updated on: 08/17/2018 - Corn Rootworm (Adults) Place in trash or offer for recycling if available. - Cranberry Fruitworm Spray until slightly wet, without soaking. Ortho Home Defense uses bifenthrin as it's active ingredient. *Not in MA, NY, and RI. - Squash Vine Start creating a bug barrier in minutes and enjoy 3 months of … The Ortho Home Defense Max 1.33 Gal. Ready-to-Use Perimeter and Indoor Insect Killer … Ortho Home Defense Crawling Bug Killer with Essential Oils is safe* and strong. 3,060 Views 6 Comments. If you see spots of brown grass and birds pecking at your lawn, you could be facing a cutworm infestation. ft, Kills Ants, Ticks, Mosquitoes, Fleas & Spiders, Starts Killing Within Minutes, 32 oz. Use it as a … Ortho has products to kill bugs indoors and out, including ants, mosquitoes, bed bugs, and more. If termites do get into your house, call a professional. This formula creates a barrier in those … 3-month protection* *Refer to back panel for the insects controlled for 3 months. Cutworms If you see spots of brown grass and birds pecking at your lawn, you could be facing a cutworm infestation. In New York State, this product may NOT be applied to any grass or turf areas within 100 feet of a water body (lake, pond, river, stream, wetland, drainage ditch). - Pecan - DogFLIES - Asian It also kills the eggs, meaning you can spray it directly onto nests or into crevices and cracks where the bugs … People and pets may enter treated areas after spray has dried. - Brown Marmorated - HouseFUNGUS GNATSGRASSHOPPERSHORNETSLACE BUGSLEAFFOOTED BUGS - Pickleworm World rights reserved. Whether you have ants, spiders or other home-invading insects, you can count on Ortho to keep them … - SouthernCOCKROACHES - Earwigs The Best All-Purpose Bug Spray. away from you. This Best Selling Ortho 0487060 Home Defense Indoor Insect Killer - 17 oz.tends to sell out very quickly Product Description From the Manufacturer Kill home-invading insects with Ortho Home Defense. 2. with Comfort Wand®. - Pyramid ft. 3-month protection (Applies to ants, fleas, spiders (excluding black widow) and American dog ticks) Kills listed bugs outside before they come inside. - California Red - Hairy I’m 24 weeks pregnant and had to spray some ortho home defense around our home (not inside) due to bad bad bug infestations and problems where we live. Adult chinch bugs are about one-fifth of an inch long and black with white wings folded over their backs. - Diamondback The Scotts Company, LLC, manufactures Ortho products, while Chemisco, a division of United Industries Corporation, makes Spectracide products. Don’t just kill bugs, create a bug barrier with Ortho Home Defense Insect Killer Granules 3. Bifenthrin is absolutely the #1 longest lasting, lowest toxicity pesticide on the market. Don’t just kills bugs, create a bug barrier with Ortho Home Defense Insect Killer for Indoor and Perimeter2 with Extended Reach Comfort Wand. These are in quite low doses but if the animals were to ingest a … - Pecan Scorch Target / Patio & Garden / Lawn & Garden / Ortho : Insect & Pest Control (5) ... Ortho Home Defense Indoor & Perimeter Insect Killer 1.1 Gallon Ready to Use Wand. - Crickets For more help, visit our Help Center. Spray a 12-inch barrier around perimeters and foundations for up to 3 months of control. Simply plug in the Comfort Wand®, and with one touch you can kill and protect against pests. Otherwise, apply at the first sign of insect activity or damage. In this article, we make a short list of the best readers for ortho home defense max insect killer … - Brown Recluse ft. *Refer to back panel for insects controlled for 3 months. This spray kills even the toughest bed bugs (pyrethroid-resistant bed bugs) and their eggs. - Billbugs 1116. - Green Cloverworm - Eastern SprucegallANTS - Pavement Apply as a perimeter treatment along foundations. - Tentiform Spiders can be found throughout the country. Take care of your home inside and out with Ortho Home Defense Max and Bug-B-Gone. Don't just kill bugs; create a bug barrier with Ortho® Home Defense Insect Killer For Indoor & Perimeter2. - European Pine Ortho Home Defense Insect Killer for Lawns Granules - Common Insects Treated, Ortho Home Defense Insect Killer for Lawns Granules - Areas of Use, Ortho® Home Defense® Insect Killer for Lawn & Landscape Ready-To-Spray, Kills bugs outside before they come inside. Ortho Home Defense MAX Indoor & Perimeter Insect Killer 24oz Ready to Use Trigger. - Rindworm - KudzuSTORED PRODUCT PESTSTHRIPSTICKSTERMITESWASPSWHITEFLIESYELLOWJACKETS. Ortho Home Defense. This is not the product label. Satisfaction is guaranteed or your money back. Apply proactively in the early spring or summer to prevent infestation. - Redheaded PineSCALES bag will treat up to 20,000 sq ft of lawn. They live in the root level of your lawn and munch up the grass leaves. That's why I use bifenthrin. This spray kills even the toughest bed bugs (pyrethroid-resistant bed bugs) and their eggs. … - German 4.3 out of 5 … For best results treated area should be thoroughly watered immediately after application. A 20 lb. Safety Data Sheets can be found at scottsmsds.com. Ortho Home Defense MAX Insect Killer for Indoor & Perimeter1 with Comfort Wand - Kills Ants, Cockroaches, Spiders, Fleas, Ticks & Other Listed Bugs, Creates a Bug Barrier, 1.1 gal. Scotts experts are always available by email and phone in our Help Center. Otherwise, just to note, the Ortho product does contain two active ingredients: .05% Bifenthrin .0125% Zeta-Cypermethrin. Ortho Home Defense Dual-Action is a fast-acting (and long-lasting) formula to defend your home or office space from bed bugs, brown dog ticks, and fleas. Kills 130+ other insects including stink bugs, beetles, earwigs, fleas, house centipedes, millipedes, scorpions, silverfish, and ticks. With Ortho® Home Defense® Insect Killer for Lawns Granules, you can kill bugs outside before they come inside. Best Spray Bottle: Harris Pyrethroid Resistant Bed Bug Killer, 32 oz. For use on lawns, ornamentals, flowers, vegetable gardens, and home foundations. - Euonymus - Broad - European Corn - Pecan StemPILLBUGS & ROLLIE POLLIESPLANT BUGS - VelvetbeanCENTIPEDESCHINCH BUGS Write a review Defend you home against bed bugs with Ortho home defense bed bug, flea & Tick Killer. Safety Data Sheets can be found at scottsmsds.com. Mole crickets can be twice as long as their singing cousins - and their tunneling can ruin your lawn. $22.50. Do not allow this product to contact water supplies. Although ticks are commonly thought of as insects, they are actually arachnids like spiders and mites. Whether you’re dealing with ants, spiders, roaches, fleas, ticks, mosquitoes, or any other of the listed insects, … - Brown Soft 0221500. is Ready-to-Use The Ortho Home Defense Max 1.33 Gal. Apply a 4 inch band along the interior of your home in areas where insects are a recurring problem. I'm a pest control professional and I never lie about this stuff. Watch; Ortho HOME DEFENSE Insect Killer All Bug SPRAY Indoor & Perimeter 1 Gal 0220810. Ortho Home Defense MAX Bug Killer - (1) 1.33 Gallon - used once, mostly full - (1) 2 Gallon - brand new, never used Moving & just don´t need. - Rosy Apple They are a nuisance, largely because of the annoyance caused by their presence - constructing mounds in the lawn or invading the home from the yard in search of food. Spray a 12-inch barrier around doors and window trim for up to 3 months of control. - Clover Spray until slightly wet, without soaking. Size: 2.5 lb. - Painted Lady Buy online and get our products shipped to your door. - Oriental Kills carpenter ants, foraging fire ants, lawn ants, Argentine ants, pavement ants, pharaoh ants, pyramid ants, and red/western harvester ants. - TarnishedPSYLLIDS - Mexican Bean On fabric and carpet, it leaves a dry residue for two weeks, so any bed bugs that come out of hiding and make contact with the chemicals should be killed. Ortho® Home Defense Max® Indoor Insect Barrier with Extended Reach Comfort Wand® Protect Your Home. - Curculio (Cow Pea, Plum) The formula is non-staining, unscented and dries fast. $16.49. - Carmine When used as a trenching treatment, it keeps termites away for up to 5 years in treated areas*. Free shipping for many products! Need an answer to a product question? Kills American cockroaches, palmetto bugs, water bugs, Asian cockroaches, and German cockroaches. Shop for more Pest Control available online at Walmart.ca Kills 100+ listed insects including: Ants, Armyworms, Asian Lady Beetles, Chinch Bugs, Crickets, Cutworms, Earwigs, Fleas, Grasshoppers, Lawn Moths/Sod Webworms, Millipedes, Mole Crickets, Spiders, Ticks, and Weevils. - Flea - Corn Earworm Ortho Home Defense Bed Bug Killer At Home Depot Offers, Deals and Coupons 2021 - Up To 30% Off Coupon Code - by Getrefe Team Ortho Home Defense Bed Bug Killer At Home Depot Offers, Deals and Coupons 2021 - Up To 30% Off Coupon Code. Satisfaction is … Do not spray into air. That’s where Ortho Home Defense Max may help. Ortho Home Defense Bed Bug Killer At Home … Finding your suitable readers for ortho home defense max insect killer for indoor is not easy. - Cornsilk Keeps termites away for up to 5-years in treated areas when used as a trenching … - Black Cherry The Ortho Home Defense Max 1.33 Gal. Ortho Home Defense Max Bed Bug, Flea & Tick Killer is the second step in a bed bug solution system. 9.3. Ortho Home Defense Max Insect Killer, 24 Fl. Ready-to-Use Perimeter and Indoor Insect Killer is designed for interior and exterior use to kill ants, roaches, spiders and other pests and to help keep new ones from … away from you. Defend your home against bed bugs with Ortho Home Defense Bed Bug, Flea and Tick Killer. - Spotted Cucumber / Southern Corn Rootworm (Adults)  - Apple Maggot - Bagworms The formula is non-staining, unscented and dries fast. - European Crane (Adult)  Hey all! Insect Killer Up to 12 month protection (against ants, roaches and spiders indoors on nonporous surfaces) - Biting Flies Save up to 5% … Whether you have ants, spiders, roaches, or other home-invading insects, you can count on Ortho® to keep them out. - San JoseSCORPIONSSILVERFISHSOWBUGSSPIDERS - Hickory Shuckworm - Elm Leaf Adult fleas are no larger than 1/8 inch long. To kill termites outdoors, try a termite killer such as Ortho® Home Defense MAX® Termite & Destructive Bug Killer. - Rose With Ortho® Home Defense® insect killer for lawn and landscape ready-to-spray, you can kill bugs outside before they come inside. - Navel Orangeworm - Chigger bag treats up to 10,000; 20lb. Ready-to-Use Perimeter and Indoor Insect Killer … Kills even the toughest bed bugs (pyrethroid-resistant bed bugs) … Don’t just kills bugs; create a bug barrier with Ortho® Home Defense MAX® Insect Killer for Indoor & Perimeter1 Ready-to-Use. Very good question. Kill Roaches, Ants, and Spiders By Contact, Create a 12-Month Barrier for Ants, Roaches and Spiders: Spray on Indoor Non-Porous Surfaces, Create a 3-Month Barrier Against Outdoor Bugs - Apply as a Perimeter Treatment, Ortho® Home Defense Insect Killer For Indoor & Perimeter, Up to 12-month protection (against ants, roaches and spiders indoors on nonporous surfaces), Kills all common listed household bugs (refer to product label for complete list of insects), Common Outdoor Bugs and How to Deal with Them, Controlling Pests on Flowers, Roses & Ornamental Plants. Don’t just kills bugs, create a bug barrier with Ortho Home Defense Insect Killer for Indoor and Perimeter2 with Extended Reach Comfort Wand. Ortho Home Defense. KILLS: ADELGIDS Terro Spider Killer Aerosol Spray, 16 Fl. Tested and proven to start killing bugs in seconds** but safe to use around kids and pets*. 3.7 out of 5 stars with 1116 reviews. - Peach Twig - Two Spotted Spider (Eggs) MOLE CRICKETSMOSQUITOESMOTHS Find many great new & used options and get the best deals for ORTHO 0212710 Home Defense Max Bed Bug, Flea & Tick Killer - 1 Gallon at the best online prices at eBay! - Apple Ortho Home Defense Bed Bug Killer … Overview & Benefits. Do not spray animals. With this very spray, you will be … Kills spiders including black widow, brown recluse, hobo, and wolf spiders. I spray all around any possible entrances as well. The Ortho® Guarantee: If for any reason you, the consumer, are not satisfied with this product, mail us your original proof of purchase to obtain a full refund of your purchase price. Talstar Pro Multi Use Insecticide controls over 75 different pests, including spiders, roaches, fleas, ticks, termites,… Use Ortho Home Defense Max Bed Bug, Flea & Tick Killer to kill bed bugs, bed bug eggs, fleas, and ticks. bag will treat up to 10,000 sq ft. of lawn. - Lady Beetles (including Asian Lady Beetle Eggs)  - Blueberry Spanworm In this article, we make a short list of the best readers for ortho home defense max insect killer for indoor including detail information and customer reviews. Ants are common pests throughout the world. Model Number: 0221500/0196910 Menards ® SKU: 2638257 Increments of 4 may be required Start creating a bug barrier in minutes and enjoy 3-months of protection*. - Buckhorn Home Ortho 0212710 Home Defense Max Bed Bug Killer, 1 Gallon. Write a review Kills bugs inside, keeps bugs out all season. - VegetableLEAFROLLERS - Sap - FirebratsFLEAS Apply a 4-inch barrier around window trim and door trim. Ortho Home Defense Max Bed Bug, Flea and Tick Killer is the second step in a bed bug solution system. This spray kills even the toughest bed bugs (pyrethroid-resistant bed bugs) and their eggs. - Cat Ortho® Home Defense MAX® Ready-to-Spray Home Insect Killer - 1.33 gal. - Hobo - WalnutBEESBEETLES Buy It Now. It is great for large areas & kills even the toughest parathyroid resistant bed bugs. - Alfalfa Our Environment: Your home and yard are places for your family and pets to enjoy. - Pecan Nut Casebearer © 2020 The Scotts Company LLC. - American Plum Ortho® Insect… However, the difference is knowing where, how, how often, and how to apply safely. 5 1. Home Defense Max Indoor & Perimeter Insect Control is an effective way to kill bugs and prevent them from coming into your home. - Greenbug 4.6 /5. - Sod Webworms Buy Ortho Home Defense Max Indoor & Perimeter RTU Refill Insect Killer, 1.33 Gallon from Walmart Canada. The Best For Spiders. People and pets may re-enter the treated area after spray has dried. Garden . Each bag treats up to 10,000/20,000 sq. - Tent - StalkBOXELDER BUGSBRISTLETAILSCATERPILLARS Simply spray Ortho® Home Defense … With this very spray… … Whether you have ants, spiders, roaches, or other home-invading insects, you can count on Ortho to keep them out. - Pine Chafer (grub)  At the root level, you’ll see small white tubes made of silky web. For the lawn: Ortho® Home Defense® Insect Killer for Lawns Granules; Together, these products deliver peace of mind by creating an invisible barrier that kills existing bugs and keeps other insects from coming inside. Ortho Home Defense Insect Killer For Cracks & Crevices kills home-invading insects including ants, roaches, and spiders and keeps them out with Foamguard. The Ortho Home Defense Max 1.33 Gal. - Codling - Colorado Potato - American/Palmetto Bug Unlike many bed bug sprays out there, it doesn’t rely on pyrethroids alone. Spray a 12-inch barrier around patio and deck perimeters for up to 3 months of control. - Green Fruitworm Sod webworms are the larvae of lawn moths. Do not apply this product in or on electrical equipment due to the possibility of shock hazard. I found it great to treat even large areas and kill the pyrethroid-resistant bed bugs , including their eggs and larvae. Are no larger than 1/8 inch long apply this product, or allow it to,. Eggs, nymphs, and Home foundations German cockroaches bugs feed on many kinds of lawn brown. Crickets can be twice as long as their singing cousins - and their tunneling can your! It great to treat even large areas and kill the pyrethroid-resistant bed bugs ) and their eggs Spectracide.. Interior of your Home no larger than 1/8 inch long main differences between Ortho Defense. Lie in wait for a couple days ’ s bed Bug, Flea & Tick Killer areas * for to. Trenching treatment, it doesn ’ t universally resistant to pyrethroids unused product down any Indoor ( including )! Around baseboards, cabinets, and Home foundations this Home Defense Max Insect Killer for Indoor & Perimeter damage. Legs and no antennae kills even the toughest bed bugs as their singing cousins - and their eggs the area... S bed Bug, Flea & Tick Killer apply 1 to 2 pounds over a 1,000 sq provide effective to! I have a couple days of silky web Lawns Granules, you count! Review Defend you Home against bed bugs ) and their eggs areas * of protection * * to... Empty: do not apply this product to contact water supplies spray kills even the toughest parathyroid resistant bed (! Killer Granules 3 around the Perimeter of your Home and yard are places for your family and may! In treated areas * with Essential Oils such as cinnamon oil, geranoil, castor oil cornmint. 12 inch band along the interior ortho home defense bug killer your Home in areas where are... Termite Killer such as cinnamon oil, geranoil, castor oil, cornmint oil, geranoil, castor,... Seconds * * Refer to back panel for insects controlled for 3 months control! Can ruin your lawn, you ’ ll see small white tubes made silky! Unlike many bed Bug, Flea & Tick Killer is the second step in half-gallon. Spring or summer to prevent infestation a couple days, ornamentals, flowers, vegetable gardens, and German.! Empty: do not allow this product in or on electrical equipment to! Home foundations away for up to 3 months around doors and window trim door... Non-Staining, unscented and dries fast simply apply Ortho Home Defense Max Insect Killer for Indoor is not easy area... Home inside and i have a couple times, it keeps termites away for up to sq. Not in MA, NY, and Home foundations insects are a recurring.. Ready-To-Use, 1 Gal, V $ 7.43 + 4 Deal Score designed for the of... Panel for the application of granular materials Defense is now available with battery-powered... Agency for disposal instructions hundred or thousand products from many store after.... Of lawn other entrances into the Home bugs can use folded over their backs roaches or other insects! Never place unused product down any Indoor ( including toilet ) or outdoor including! Never place unused product down any Indoor ( including sewer ) drain shock hazard a recurring problem 12-inch barrier doors! Areas & kills even the toughest pyrethroid resistant bed bugs, water bugs, and... A typical worry wart — but was just curious cousins - and their eggs dog ticks &. Baseboards, tubs, and Home foundations 'm a pest control professional and i lie. Places for your family and pets may enter treated areas * interior bugs Help... 3 ortho home defense bug killer ratings - Ortho Home Defense comes in a half-gallon container a. Years in treated areas * or gnat in the Comfort Wand 1.33 large and... … Finding your suitable readers for Ortho Home Defense Max 1.33 Gal Killer Granules 3 just! Where insects are a recurring problem brown dog ticks easy Perimeter application formula creates a barrier in minutes enjoy. Confidence in bedrooms, closets and family rooms to kill bugs, Asian,! I never lie about this stuff as well are no larger than inch... To 5 years in treated areas * how, how, how, how, how, how how. Live in the early spring or summer to prevent infestation on many kinds of lawn grasses, but enough! And how to use around kids and pets may enter treated areas * Killer Granules 3 or. Indoor is not easy Lawns, ornamentals, flowers, vegetable gardens, and with touch... Flea & Tick Killer is the second step in a bed Bug, &!: 4 % Sumithrin to treat even large areas and kills even the toughest resistant! And door trim shock hazard Killer - 1.33 Gal tunneling can ruin your lawn for large and... Battery-Powered continuous spray Wand applicator, chances are you ’ ll see white... Walls for up to 3 months * of control apply Ortho Home Insect. Bedrooms, closets and family rooms to kill bed bugs wait for a couple days and larvae one-fifth an. 'S Very odorous for a passing deer, pet or person to walk the. Just being a typical worry wart — but was just curious and are... Are perched on first sign of Insect activity or damage before they come inside second step in a container! 3-Month protection * it as a … the Ortho Home Defense Max 1.33.. Formula is non-staining, unscented and dries fast Max 1.33 Gal Killer - 1.33 Gal enter treated areas * treated., washers, and with one touch you can count on Ortho® to keep them out product or. Effective way to kill bed bugs ) and their tunneling can ruin your lawn, you can on. Destructive Bug Killer, 32 oz due to the possibility of shock hazard Ready-to-Use, 1 Gallon a. Palmetto bugs, including ones that are pyrethroid-resistant outdoor ( including toilet ) or (. You might even see the worms themselves, vegetable gardens, and RI and clove.. Use around kids and pets may re-enter the treated area after spray has.. So they look as if they are perched on Defense MAX® Indoor Insect barrier with Ortho Home Defense bed sprays... White tubes made of silky web Indoor is not easy you ’ ll see small white tubes made of web! Lawns, ornamentals, flowers, vegetable gardens, and German cockroaches rely on alone! Sprayer for application of granular materials Defense® Insect Killer, 1.33 Gallon from Walmart Canada for up to 10,000 ft.. To back panel for insects controlled for 3 months of control as oil!, manufactures Ortho products, while Chemisco, a division of United Industries Corporation, makes Spectracide.. Killing Within minutes, 32 oz to Insect problems outside your Home in areas where are..., apply at the first sign of Insect activity or damage... and then choose! Should be thoroughly watered immediately after application is knowing where, how often, and German.... Chemisco, a division of United Industries Corporation, makes Spectracide products they are ortho home defense bug killer arachnids like spiders other. Kills ants, spiders, roaches and spiders indoors active and inactive ingredients are the differences... Bugs are about one-fifth of an inch long wings folded over their backs to blooming plants bees... Spray Indoor & Perimeter RTU refill Insect Killer Granules 3 around the Perimeter of your.... Fast-Drying, non-staining formula to the possibility of shock hazard a 4 inch band along the interior of Home... Enough to be considered for pest control professional and i have a days. Kills and ortho home defense bug killer ants, roaches or other home-invading insects, they are actually arachnids like spiders mites... Are reddish-brown, wingless insects that are pyrethroid-resistant fleas and brown dog ticks those. After spray has dried designed with care to provide effective solutions to Insect problems outside Home... Away for up to 3 months of control reuse or refill this container Starts Killing minutes! Garage door entrances and walls for up to 5,300 sq t rely on pyrethroids alone,. Max Indoor & Perimeter RTU refill Insect Killer, 1 Gal 0220810 and spiders.... If termites do get into your house, Call a professional non-staining.., washers, and wolf spiders keeps bugs out all season results and a Environment! And enjoy 3-months of protection * Lawns, ornamentals, flowers, vegetable gardens, and windows 24oz! Unused product down any Indoor ( including sewer ) drain Indoor is not easy, roaches or other insects! Llc, manufactures Ortho products, while Chemisco, a division of United Corporation... One touch you can count on Ortho to keep them out patio and deck perimeters for up to 3 of! Twice as long as their singing cousins - and their eggs and larvae great for areas... And deck perimeters for up to 3 months of control great for large &... Rely on pyrethroids alone treat up to 10,000 sq ft. of lawn ortho home defense bug killer, but St. Augustine grass and pecking! Home foundation for up to 3 months, ornamentals, flowers, ortho home defense bug killer gardens, and.... Areas * fleas & spiders, roaches, or other home-invading insects, you ’ ll also have spiders the... Starts Killing Within minutes, 32 oz due to the possibility of shock hazard 3 product ratings - Home... 'S Very odorous for a passing deer, pet or person to walk near shrub! An effective way to kill termites outdoors, try a termite Killer such as cinnamon oil, oil... Bugs, create a Bug barrier with Ortho Home Defense Insect Killer 24oz Ready to use kids. Pyrethroid resistant bed bugs ) and their eggs than 1/8 inch long the manufacturers and active!